PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN14496.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 177aa    MW: 20068 Da    PI: 9.4767
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN14496.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.91.5e-201461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lv +v+++G+g+W++++++ g+ R++k+c++rw +yl
       KHN14496.1 14 KGPWTPEEDKKLVAYVEEHGPGNWRSVPAKAGLERCGKSCRLRWINYL 61
                     79********************************************97 PP

2Myb_DNA-binding51.91.8e-1667110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+++ eEd  +++++++lG++ W+ Ia++++ +Rt++++k++w++
       KHN14496.1  67 RGNFSMEEDHTIIQLHALLGNK-WSIIAAHLP-NRTDNEIKNYWNT 110
                      89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-27564IPR009057Homeodomain-like
PROSITE profilePS5129427.402965IPR017930Myb domain
SuperFamilySSF466891.05E-3311108IPR009057Homeodomain-like
SMARTSM007173.1E-161363IPR001005SANT/Myb domain
PfamPF002494.9E-191461IPR001005SANT/Myb domain
CDDcd001671.23E-121661No hitNo description
Gene3DG3DSA:1.10.10.602.6E-2665117IPR009057Homeodomain-like
PROSITE profilePS5129420.52266116IPR017930Myb domain
SMARTSM007179.3E-1466114IPR001005SANT/Myb domain
PfamPF002491.4E-1567110IPR001005SANT/Myb domain
CDDcd001672.86E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MGRMPCCEKV GLKKGPWTPE EDKKLVAYVE EHGPGNWRSV PAKAGLERCG KSCRLRWINY  60
LKPDIKRGNF SMEEDHTIIQ LHALLGNKWS IIAAHLPNRT DNEIKNYWNT NIKKRLIRMG  120
LDPITHKPIK SNSFEAYDEF KDTTNMGHVA QWESARLEAE ARGSILQVGS GSSNLPG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C5e-30121162105C-Myb DNA-Binding Domain
1msf_C5e-30121162105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150432e-49AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014621940.11e-132PREDICTED: myb-related protein 308-like
SwissprotQ9SPG25e-69MYB28_ARATH; Transcription factor MYB28
TrEMBLK7K7N81e-132K7K7N8_SOYBN; Uncharacterized protein
STRINGGLYMA02G12242.11e-131(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13536826
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.12e-88myb domain protein 16